PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00051540-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 336aa    MW: 37004.4 Da    PI: 8.4786
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00051540-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431.1e-1378122347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++ ++ + ++lG+g+W+ I+r + + Rt+ q+ s+ qky
  PSME_00051540-RA  78 PWTEEEHKMFLLGLHKLGKGDWRGISRNFVTSRTPTQVASHAQKY 122
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.092320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.16171127IPR017930Myb domain
SuperFamilySSF466891.87E-1773128IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-1874126IPR006447Myb domain, plants
SMARTSM007177.9E-1175125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-1175121IPR009057Homeodomain-like
PfamPF002493.1E-1178122IPR001005SANT/Myb domain
CDDcd001671.52E-978123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MNRRCSHCGY NGHNSRTCPE RGVKLFGVRL TADEPMRKSL SMGNLPLTPE QSESGAAEDG  60
YVSDGLVHNS RERKKGVPWT EEEHKMFLLG LHKLGKGDWR GISRNFVTSR TPTQVASHAQ  120
KYFLRQSNLN KRKRRSSLFD ISTDSVEDCY QGIPELSPVM HELSLGQNSS LTSGNFFETR  180
RPPPNLAASV GAFSIPPLAA PRTVNPPCLS LGMSRSDKSD DDERARGEAK YSYLKMAECQ  240
EPGQYSNPNS HYSFTLPFWP ELATKASNVI KPSAPTSPAM EARESIENSG LSLSIAPPCV  300
DPPPPHNTLN LDQSNSHRSA FRSSNLDSNS NAISVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1136970.0BT113697.1 Picea glauca clone GQ03417_N02 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001764790.11e-78predicted protein
TrEMBLA0A0D6R0341e-149A0A0D6R034_ARACU; Uncharacterized protein
STRINGPP1S66_90V6.12e-80(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-67MYB_related family protein